PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0012s0660.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 1726aa    MW: 195214 Da    PI: 6.14
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0012s0660.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.91.9e-192782257
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                             kR+  t+ qle+Le++++ + yps+e+r+eL++klgL++rq ++WF+ rR k+kk
  SapurV1A.0012s0660.2.p 27 PKRQMKTPFQLETLEKAYAAETYPSEEMRAELSEKLGLSDRQLQMWFCHRRLKDKK 82
                            69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-19883IPR009057Homeodomain-like
SuperFamilySSF466893.42E-171583IPR009057Homeodomain-like
PROSITE profilePS5007117.22383IPR001356Homeobox domain
SMARTSM003895.2E-192587IPR001356Homeobox domain
PfamPF000464.1E-172782IPR001356Homeobox domain
CDDcd000862.76E-142883No hitNo description
SMARTSM005714.3E-22514573IPR018501DDT domain
PROSITE profilePS5082716.662514573IPR018501DDT domain
PfamPF027916.7E-18515570IPR018501DDT domain
PfamPF050664.5E-16698766IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156126.9E-7905948IPR028942WHIM1 domain
PfamPF156131.8E-1310871159IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1726 aa     Download sequence    Send to blast
MEANSDEEDH NRSKSNVMSS NEGQSKPKRQ MKTPFQLETL EKAYAAETYP SEEMRAELSE  60
KLGLSDRQLQ MWFCHRRLKD KKETPVKKQR NAAPLPESPL EEMRVAGAEN GSDYGSGSGS  120
GSSPLSESRK VVLDDGHMMR RYYDSSPQSV MELRAIACVE AQLGEPLRED GPILGMDFDH  180
LPPDAFGTPI ASISEQQKRM GYSYEDKIYE RHDAKSSKDH ASIRSDAYGL AQSPYHDSPA  240
DTLRGRASPF GAGQMPRARL LSQQDKRGHI FSSPQRDDDF IPQRDTFANN RTSAQSITHP  300
IMGPENPNVF SDAQTFHHDT ELRLERKRKI EEPRTIRDVE AYESRMRKEL EKQDILRRKN  360
EERMRKEMER HDRERRKEEE RLMRERQREE ERTLREQKRE HERREKFMQK EYLRAEKRRQ  420
KEELRREKEA VKRKAAMEKA TARKIAKDSL DLIEDEQLEL MELAAASKGL ASIVNLNYDT  480
LQNLDSFRDL LITFPSKSVQ LKKPFGFQPW LDSEENIGNL LMVWRFFITF ADVLGLWPFT  540
LDEFVQAFHD YDSRLLSELH IALLKLIIKD IEDVARTPSS GLGINQYYTA NPEGGHPQIV  600
RGAYTWGFDI RNWQQHLNPL TWPEILRQLA LSAGFGPQLR KRNATWTGLG DIDELQVKDC  660
EDIISTIRNG SAAENAFALM REKGLLLPRR SRHRLTPGTV KFAAFHVLSL EGSKGLTVLE  720
LADKIQKSGL RDLTTSKTPE ASISVALTRD QKLFERIAPS TYCLRAAFRK DPADAEAILA  780
AARKKIRIFE NGFLGGEVVD DVERDEDSEG DEDPEVDDLT TPLSANKSFV HSSKLNTLPV  840
SGKYKVGNDV SLTVQNESEK GLSTFSLNGP KDVMAPIIIE QCVTHKDEGT NNGNGRDIEI  900
DETKSGESWI QGLTEGEYSH LTVEERLNAL VVLVGIANEG NSIRAVLEDR LEAANALKKQ  960
MWAEAQLDRS RLKEEFVSKL DFPSLTVGRV ETQFASSAVE GSQSPLVLAD SKNKEASPSN  1020
AEDRKPLAEN VENHLSIVLS EKALVVQDLS MNPDNISMQQ HGYASKRSRS QLKAYVTHLA  1080
EEMYIYRSLP LGQDRRRNRY WQFVASASRN DPCSGRIFVE LHDSNWRVID SEEAFDTLLS  1140
SLDTRGVRES HLRIMLQKIE SSFKENLQRN LWSPSIVCQS GTTDDKKAEK DNGNCAASID  1200
GPSSMLRVSS SDSFDTFSSF RIELGRTSAE KKGALKRYQD FQNWMWKDCF NSSTLCSMKY  1260
GKKRCEQLLD TCNLCFSSYL SEDTHCLSCH QAFKVDNKNF DFAEHEIQCK EKSFDPGNAR  1320
ACDSCLPLGV RLLTALLGSI EVSVPQEALE SFWMEIRRKD WGVKLIKSSS TEELLQRLTV  1380
FESAIKRQRL SSNFETTKEL LGSSVSSGSA AHDSASLGSV SLLPWIPKTS AAMALRLFEL  1440
DASIIYVKNE KPEPSTDKSV KVYMKLPSRY SDFKNEVEIK DVKLEEHNKE IVDLRGKRSN  1500
YKRGRGGRDQ GLATKWQRRV PGLKSDTRRQ SSSRGVQNLN QGSRQQGRKT NLQASSRGRR  1560
TVRKRRVEKM VAKEPLPGRM TNKVAAPMSY LSKKTAVHNS YVKSFRNLDD EDWSAKRGRM  1620
NAVGDDNSNS MEEAESDDNV EEEVSGQGNW EPRFNGTPNG WNGNSMEVSD DDGDASNGDA  1680
SNGVAAMGDD DSEGDVEMSD RSDREANQVQ NDEGLDFADS DEYSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17582RRLKDKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027776.10.0PREDICTED: uncharacterized protein LOC105127984 isoform X3
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLB9H2Q70.0B9H2Q7_POPTR; Uncharacterized protein
STRINGPOPTR_0004s04840.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1